(data stored in ACNUC7421 zone)

EMBL: CP000094.PE52

CP000094.PE52        Location/Qualifiers
FT   CDS             complement(58135..58776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0052"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71796"
FT                   /db_xref="GOA:Q3KKB0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB0"
FT                   /protein_id="ABA71796.1"
FT                   /translation="MRNLIISAALVAASLFGVTAQAAEAPAAPYVELSNPVPVAVPGKI
FT                   EVVELFWYGCPHCYAFEPVINPWVEKLPSDVNFVRIPAMFGGPWDAHGQMFLTLEAMGV
FT                   EHNVHAAVFNAIQKEHKKLTDKNDMADFLATQGVDKDKFLATFDSFAIKGQIVKARELA
FT                   KKYEISGVPTMIVNGKYRFDIGSAGGAEQALKLADQLVAKERATNKAAAN"
     MRNLIISAAL VAASLFGVTA QAAEAPAAPY VELSNPVPVA VPGKIEVVEL FWYGCPHCYA        60
     FEPVINPWVE KLPSDVNFVR IPAMFGGPWD AHGQMFLTLE AMGVEHNVHA AVFNAIQKEH       120
     KKLTDKNDMA DFLATQGVDK DKFLATFDSF AIKGQIVKAR ELAKKYEISG VPTMIVNGKY       180
     RFDIGSAGGA EQALKLADQL VAKERATNKA AAN                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page