(data stored in ACNUC7421 zone)

EMBL: CP000094.PE522

CP000094.PE522       Location/Qualifiers
FT   CDS             606322..607623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0524"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72268"
FT                   /db_xref="GOA:Q3KIY8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY8"
FT                   /protein_id="ABA72268.1"
FT                   /translation="MFFERHGGGERVILVHLDGQDPEAREDPQEFQELANSAGAETVAF
FT                   FNVPRHRPTAKYLIGSGKVEELRDLVHAEEADLVIFNHTLTPSQERNLERVFECRVIDR
FT                   TGLILDIFAQRARTHEGKLQVELAQLDHMSTRLVRGWTHLERQGGGIGMRGPGETQLET
FT                   DRRLLRVRLRQIKRRLEKVRSQREQSRRGRSRADIPTVSLVGYTNAGKSTLFNNVTKSE
FT                   VYAADQLFATLDPTLRRLDLDDLGPIVLADTVGFIRHLPHKLVEAFRSTLEESSNSDLL
FT                   LHVIDAAEPDRMLQIEQVMVVLGEIGAQDLPILEVYNKLDLLEGVEPQIQRDENGKPQR
FT                   VWLSARDGTGLELLEQAIAELLGSDLFVGTLRLPQRFARLRAQFFELGAVQKEEHDEEG
FT                   VSLLAVRLPRSELNRLVSREGVVPTEFIEQHTLQ"
     MFFERHGGGE RVILVHLDGQ DPEAREDPQE FQELANSAGA ETVAFFNVPR HRPTAKYLIG        60
     SGKVEELRDL VHAEEADLVI FNHTLTPSQE RNLERVFECR VIDRTGLILD IFAQRARTHE       120
     GKLQVELAQL DHMSTRLVRG WTHLERQGGG IGMRGPGETQ LETDRRLLRV RLRQIKRRLE       180
     KVRSQREQSR RGRSRADIPT VSLVGYTNAG KSTLFNNVTK SEVYAADQLF ATLDPTLRRL       240
     DLDDLGPIVL ADTVGFIRHL PHKLVEAFRS TLEESSNSDL LLHVIDAAEP DRMLQIEQVM       300
     VVLGEIGAQD LPILEVYNKL DLLEGVEPQI QRDENGKPQR VWLSARDGTG LELLEQAIAE       360
     LLGSDLFVGT LRLPQRFARL RAQFFELGAV QKEEHDEEGV SLLAVRLPRS ELNRLVSREG       420
     VVPTEFIEQH TLQ                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page