(data stored in ACNUC7421 zone)

EMBL: CP000094.PE524

CP000094.PE524       Location/Qualifiers
FT   CDS             608889..609758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0526"
FT                   /product="protease FtsH subunit HflC"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72270"
FT                   /db_xref="GOA:Q3KIY6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY6"
FT                   /protein_id="ABA72270.1"
FT                   /translation="MSNKSLIALIVGVVVVLVGWNCFYIVAQTERAVLLQFGRVVQADV
FT                   QPGLHVKVPYVNQVRKFDARLMTLDAPTQRFLTLEKKAVMVDAYAKWRVKDAERFYTAT
FT                   SGLKQIADERLSRRLESGLRDQFGKRTLHEVVSGERDALMADITASLNKMAEKELGIEV
FT                   VDVRVKAIDLPKEVNRSVFERMSTEREREAREHRAKGNELAEGIRADADRQRRVLLAEA
FT                   YRESEEIRGDGDAQAAAIYSKAYGQDQEFYGFYRSLRAYRESFANKSDVLVLDPSSDFF
FT                   RYLEKSKP"
     MSNKSLIALI VGVVVVLVGW NCFYIVAQTE RAVLLQFGRV VQADVQPGLH VKVPYVNQVR        60
     KFDARLMTLD APTQRFLTLE KKAVMVDAYA KWRVKDAERF YTATSGLKQI ADERLSRRLE       120
     SGLRDQFGKR TLHEVVSGER DALMADITAS LNKMAEKELG IEVVDVRVKA IDLPKEVNRS       180
     VFERMSTERE REAREHRAKG NELAEGIRAD ADRQRRVLLA EAYRESEEIR GDGDAQAAAI       240
     YSKAYGQDQE FYGFYRSLRA YRESFANKSD VLVLDPSSDF FRYLEKSKP                   289
//

If you have problems or comments...

PBIL Back to PBIL home page