(data stored in ACNUC7421 zone)

EMBL: CP000094.PE525

CP000094.PE525       Location/Qualifiers
FT   CDS             610072..611259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0527"
FT                   /product="putative ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72271"
FT                   /db_xref="GOA:Q3KIY5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIY5"
FT                   /protein_id="ABA72271.1"
FT                   /translation="MATVDRWLLPDGIEEVLPPEAARIEVARRQVLDLFQSWGYEFVVT
FT                   PHIEYLESLLTGAGQDLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLRREGPSRL
FT                   CYAGSVLHAQPRALSSSRSPIQLGAELYGDASPSSDVEVISLMLAMLQLADVPDVHMDL
FT                   GHVGIYRGLAQAAGLSGEVEQQLFDALQRKAIDEVITLTEGLPADLSGMLRALVDLCGG
FT                   REVLSAARERLANAPAPVLAALEDLLAIAERLSVRFPELPLYFDLGELRGYHYHTGVVF
FT                   AVFVPGVGQSIAQGGRYDDIGADFGRARPATGFSTDLKTLVTLGRAEIELPSGGIWMPD
FT                   STDAALWQQVCQLRSEGQRVVQALPGQPLAAARDADCDRQLIQQNGLWQVSPLAS"
     MATVDRWLLP DGIEEVLPPE AARIEVARRQ VLDLFQSWGY EFVVTPHIEY LESLLTGAGQ        60
     DLDLRTFKVI DPQSGRQMGF RADITPQVAR IDAHTLRREG PSRLCYAGSV LHAQPRALSS       120
     SRSPIQLGAE LYGDASPSSD VEVISLMLAM LQLADVPDVH MDLGHVGIYR GLAQAAGLSG       180
     EVEQQLFDAL QRKAIDEVIT LTEGLPADLS GMLRALVDLC GGREVLSAAR ERLANAPAPV       240
     LAALEDLLAI AERLSVRFPE LPLYFDLGEL RGYHYHTGVV FAVFVPGVGQ SIAQGGRYDD       300
     IGADFGRARP ATGFSTDLKT LVTLGRAEIE LPSGGIWMPD STDAALWQQV CQLRSEGQRV       360
     VQALPGQPLA AARDADCDRQ LIQQNGLWQV SPLAS                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page