(data stored in ACNUC7421 zone)

EMBL: CP000094.PE532

CP000094.PE532       Location/Qualifiers
FT   CDS             621769..622197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0534"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72278"
FT                   /db_xref="GOA:Q3KIX8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIX8"
FT                   /protein_id="ABA72278.1"
FT                   /translation="MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRR
FT                   QLAYAINNVHKAHYVMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK
FT                   AEENRSERRERRERPEHDGSADGDDSDSDSDNSDNADE"
     MRHYEIIFLV HPDQSEQVGG MVERYTKLIE EDGGKIHRLE DWGRRQLAYA INNVHKAHYV        60
     MLNVECTGKA LAELEDNFRY NDAVIRNLVI RRDEAVTGQS EMLKAEENRS ERRERRERPE       120
     HDGSADGDDS DSDSDNSDNA DE                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page