(data stored in ACNUC7421 zone)

EMBL: CP000094.PE535

CP000094.PE535       Location/Qualifiers
FT   CDS             623403..623849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0537"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72281"
FT                   /db_xref="GOA:Q3KIX5"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIX5"
FT                   /protein_id="ABA72281.1"
FT                   /translation="MQLILLEKIANLGNLGDKVNVKAGYGRNYLLPFGKATAATAANLA
FT                   AFEERRAELEKAAADRKASAESRAAQLAELEVTITATAGDEGKLFGSIGTHDIADALTA
FT                   SGVEVAKSEVRLPNGTIRNVGEFDVAVHLHAEVEATVRVVVVAA"
     MQLILLEKIA NLGNLGDKVN VKAGYGRNYL LPFGKATAAT AANLAAFEER RAELEKAAAD        60
     RKASAESRAA QLAELEVTIT ATAGDEGKLF GSIGTHDIAD ALTASGVEVA KSEVRLPNGT       120
     IRNVGEFDVA VHLHAEVEAT VRVVVVAA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page