(data stored in ACNUC7421 zone)

EMBL: CP000094.PE539

CP000094.PE539       Location/Qualifiers
FT   CDS             630724..633999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72285"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX1"
FT                   /protein_id="ABA72285.1"
FT                   /translation="MSIHVALHHVTHYRYDRAVELGPQIVRLRPAAHSRTRILSYSLKV
FT                   SPEQHFINWQQDPQGNYLARLVFPEKTAELRIEVDLLAEMAVFNPFDFFLEPYAEKIPF
FT                   AYAADERKELAPYLETLPLTPKFKAYLDAIDRTPLPAVDFLVALNQRLSEDINYLIRME
FT                   PGVQTPEHTLEHASGSCRDSAWLLVQLLRNLGLAARFVSGYLIQLTADVKSLDGPSGTE
FT                   VDFTDLHAWCEVYLPGAGWIGLDATSGLFAGEGHIPLACSPDPSSAAPISGLVEPCECE
FT                   FSHEMSVERIWEAPRVTKPYTDEQWLAIQSLGRQIDADLLEGDVRLTMGGEPTFVSIDD
FT                   PDGAEWNTAALGPDKRRLSAELFQRLRKHYAPKGLVHFGQGKWYPGEQLPRWSLNCYWR
FT                   RDGVPIWHNNALIADEQQDYGATGELAGRFLASVAERLKLPTRFVFPAYEDNFYYLWRE
FT                   GALPSNVSAEDSRLEEPLERARLRKVFSQGLDKVIGQVLPLARTAKGDQWQSGRWYLRD
FT                   EHCRLVPGDSPLGYRLPLGSQPWVKAAEYPFIHPNDPNQDFPELPETAQLNQHGEPAPA
FT                   YDRVPKIDESADWLTRTAFCAEAREGRLYLFMPPLERVEDYLELVAAIEATAEELHCPV
FT                   LLEGYEPPSDPRLNNFRITPDPGVIEVNVQPSAAWDELVERTEFLYEEARQTRLSTEKF
FT                   MVDGRHTGTGGGNHFVLGGATPGDSPFLRRPDLLRSLISYWHNHPSLSYLFSGLFIGPT
FT                   SQAPRVDEARNDALYELEIAFAQMPAPGEECAPWLVDRLLRNLLIDVTGNTHRAEFCID
FT                   KLYSPDGATGRLGLLELRGFEMPPHARMSLAQQLLLRALVARFWREPYAPPKLARWGTE
FT                   LHDRFMLPHFIEQDFADVIVELNSAGYPLRAEWFAAHLEFRFPKVGDYAVNGIELELRQ
FT                   ALEPWHVLGEEGAAGGTVRYVDSSLERLQVKLTGLPPQRYLLTCNGIPVPLQPTGRVGE
FT                   FVAGVRFRAWQPANCLQPTIPVHAPLVFDLLDTWMQRSLGGCQYHVAHPGGRNYETLPV
FT                   NANEAESRRMARFFRIGHTPGKLPIPNLTISDELPMTLDLRRF"
     MSIHVALHHV THYRYDRAVE LGPQIVRLRP AAHSRTRILS YSLKVSPEQH FINWQQDPQG        60
     NYLARLVFPE KTAELRIEVD LLAEMAVFNP FDFFLEPYAE KIPFAYAADE RKELAPYLET       120
     LPLTPKFKAY LDAIDRTPLP AVDFLVALNQ RLSEDINYLI RMEPGVQTPE HTLEHASGSC       180
     RDSAWLLVQL LRNLGLAARF VSGYLIQLTA DVKSLDGPSG TEVDFTDLHA WCEVYLPGAG       240
     WIGLDATSGL FAGEGHIPLA CSPDPSSAAP ISGLVEPCEC EFSHEMSVER IWEAPRVTKP       300
     YTDEQWLAIQ SLGRQIDADL LEGDVRLTMG GEPTFVSIDD PDGAEWNTAA LGPDKRRLSA       360
     ELFQRLRKHY APKGLVHFGQ GKWYPGEQLP RWSLNCYWRR DGVPIWHNNA LIADEQQDYG       420
     ATGELAGRFL ASVAERLKLP TRFVFPAYED NFYYLWREGA LPSNVSAEDS RLEEPLERAR       480
     LRKVFSQGLD KVIGQVLPLA RTAKGDQWQS GRWYLRDEHC RLVPGDSPLG YRLPLGSQPW       540
     VKAAEYPFIH PNDPNQDFPE LPETAQLNQH GEPAPAYDRV PKIDESADWL TRTAFCAEAR       600
     EGRLYLFMPP LERVEDYLEL VAAIEATAEE LHCPVLLEGY EPPSDPRLNN FRITPDPGVI       660
     EVNVQPSAAW DELVERTEFL YEEARQTRLS TEKFMVDGRH TGTGGGNHFV LGGATPGDSP       720
     FLRRPDLLRS LISYWHNHPS LSYLFSGLFI GPTSQAPRVD EARNDALYEL EIAFAQMPAP       780
     GEECAPWLVD RLLRNLLIDV TGNTHRAEFC IDKLYSPDGA TGRLGLLELR GFEMPPHARM       840
     SLAQQLLLRA LVARFWREPY APPKLARWGT ELHDRFMLPH FIEQDFADVI VELNSAGYPL       900
     RAEWFAAHLE FRFPKVGDYA VNGIELELRQ ALEPWHVLGE EGAAGGTVRY VDSSLERLQV       960
     KLTGLPPQRY LLTCNGIPVP LQPTGRVGEF VAGVRFRAWQ PANCLQPTIP VHAPLVFDLL      1020
     DTWMQRSLGG CQYHVAHPGG RNYETLPVNA NEAESRRMAR FFRIGHTPGK LPIPNLTISD      1080
     ELPMTLDLRR F                                                           1091
//

If you have problems or comments...

PBIL Back to PBIL home page