(data stored in ACNUC7421 zone)

EMBL: CP000094.PE541

CP000094.PE541       Location/Qualifiers
FT   CDS             636574..637464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72287"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW9"
FT                   /protein_id="ABA72287.1"
FT                   /translation="MSAHYQILHDTCYRYDSPVSLAQQLAHLWPRECEWQRCTEQQLLI
FT                   SPEPTTRRDEQDVFGNPLTRLAFERPHDELQVNARLTVEVLARPVVDFQQSPAWELTRN
FT                   ALTYSSQPLSASLLEACRYRFQSPYVHLKRSFVEFSESCFPAGRPLMLGVQALMQKIFS
FT                   EFTFDAEATQVATPLVEVLERRRGVCQDFAHLMLACVRSRGLAARYVSGYLLTQPPPGQ
FT                   PRLIGADASHAWVSVFCPVLGWVDFDPTNNVQPALEHITLAWGRDFSDVSPLRGVILGG
FT                   GSHDPEVRVTVMPLE"
     MSAHYQILHD TCYRYDSPVS LAQQLAHLWP RECEWQRCTE QQLLISPEPT TRRDEQDVFG        60
     NPLTRLAFER PHDELQVNAR LTVEVLARPV VDFQQSPAWE LTRNALTYSS QPLSASLLEA       120
     CRYRFQSPYV HLKRSFVEFS ESCFPAGRPL MLGVQALMQK IFSEFTFDAE ATQVATPLVE       180
     VLERRRGVCQ DFAHLMLACV RSRGLAARYV SGYLLTQPPP GQPRLIGADA SHAWVSVFCP       240
     VLGWVDFDPT NNVQPALEHI TLAWGRDFSD VSPLRGVILG GGSHDPEVRV TVMPLE           296
//

If you have problems or comments...

PBIL Back to PBIL home page