(data stored in ACNUC7421 zone)

EMBL: CP000094.PE542

CP000094.PE542       Location/Qualifiers
FT   CDS             complement(637529..637708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72288"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIW8"
FT                   /protein_id="ABA72288.1"
FT                   /translation="MAKPNYSFAKRQRDLAKEQKKEEKLQRKKQMAEEAALNPDGEVAT
FT                   DNDVEAPKDQAPDT"
     MAKPNYSFAK RQRDLAKEQK KEEKLQRKKQ MAEEAALNPD GEVATDNDVE APKDQAPDT         59
//

If you have problems or comments...

PBIL Back to PBIL home page