(data stored in ACNUC7421 zone)

EMBL: CP000094.PE55

CP000094.PE55        Location/Qualifiers
FT   CDS             60118..60762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0055"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71799"
FT                   /db_xref="GOA:Q3KKA7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKA7"
FT                   /protein_id="ABA71799.1"
FT                   /translation="MQLKNPILGLCQQSTFMLSAAKVDQCPDDEGFEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFKLDDERRLVDLPGYGYAKVPIPLKQHWQRHLE
FT                   AYLGGRESLKGLILMMDIRHPMTDFDLLMLDWAVAAGMPMHILLTKADKLTYGAAKNTL
FT                   LKVQSEIRKGWGDQVTIQLFSAPKRMGLEEAYTVLAGWMELADKGAELPAE"
     MQLKNPILGL CQQSTFMLSA AKVDQCPDDE GFEVAFAGRS NAGKSSALNT LTHASLARTS        60
     KTPGRTQLLN FFKLDDERRL VDLPGYGYAK VPIPLKQHWQ RHLEAYLGGR ESLKGLILMM       120
     DIRHPMTDFD LLMLDWAVAA GMPMHILLTK ADKLTYGAAK NTLLKVQSEI RKGWGDQVTI       180
     QLFSAPKRMG LEEAYTVLAG WMELADKGAE LPAE                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page