(data stored in ACNUC7421 zone)

EMBL: CP000094.PE551

CP000094.PE551       Location/Qualifiers
FT   CDS             647107..648021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0553"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72297"
FT                   /db_xref="GOA:Q3KIV9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV9"
FT                   /protein_id="ABA72297.1"
FT                   /translation="MDGIFLQQLVNGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYM
FT                   ISAYLAAISLALLAYFGIESFPLLMLGTLIFTIVITAVYGWVIERVAYKPLRNSTRLAP
FT                   LISAIGISLILQNYAQIAQGAKQQGVPTLLTGAWRVEVGTGFVQLTYTKVFILVAAFVG
FT                   MGLLTYVIKYTKLGRMCRATQQDRKMASILGINTDRVISYVFIIGAAMAALAGVLITMN
FT                   YGTFDFYAGFIIGIKAFTAAVLGGIGSLPGAMLGGIILGISESLFSGLVNSDYKDVFSF
FT                   SLLVLVLVFRPQGLLGRPLVSKV"
     MDGIFLQQLV NGLTLGSVYG LIAIGYTMVY GIIGMINFAH GEVYMISAYL AAISLALLAY        60
     FGIESFPLLM LGTLIFTIVI TAVYGWVIER VAYKPLRNST RLAPLISAIG ISLILQNYAQ       120
     IAQGAKQQGV PTLLTGAWRV EVGTGFVQLT YTKVFILVAA FVGMGLLTYV IKYTKLGRMC       180
     RATQQDRKMA SILGINTDRV ISYVFIIGAA MAALAGVLIT MNYGTFDFYA GFIIGIKAFT       240
     AAVLGGIGSL PGAMLGGIIL GISESLFSGL VNSDYKDVFS FSLLVLVLVF RPQGLLGRPL       300
     VSKV                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page