(data stored in ACNUC7421 zone)

EMBL: CP000094.PE552

CP000094.PE552       Location/Qualifiers
FT   CDS             648025..649326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0554"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72298"
FT                   /db_xref="GOA:Q3KIV8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV8"
FT                   /protein_id="ABA72298.1"
FT                   /translation="MSSTTTKSIDVKKSLVEAILAGLIALIVFGPIVGVVLDGYSFNLE
FT                   PTRVAWIIAIVMAGRFALSLFLQTPKGLRILDGFESTGSGVHVLPPDYKSRLRWIIPLM
FT                   IAIAVALPFFSNSYLLGVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLAL
FT                   GYQYLGLGFWTVLPLAAITAGLAGCILGFPVLRLHGDYLAIVTLGFGEIIRLVLNNWLS
FT                   LTGGPNGMPAPLPTFFGLEFGKRAKDGGVPFHEFFGIAYNPDVKYYFIYAVLFLVVLAV
FT                   LYIKHRLVKMPVGRAWEALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFATYQ
FT                   GFVNPTSFTFFESALILAIVVLGGMGSTIGVVIAAFVLTVAPELLRGFAEYRVLLFGIL
FT                   MVLMMIWRPRGLIRISRTGVTPRKGAIHYERTAP"
     MSSTTTKSID VKKSLVEAIL AGLIALIVFG PIVGVVLDGY SFNLEPTRVA WIIAIVMAGR        60
     FALSLFLQTP KGLRILDGFE STGSGVHVLP PDYKSRLRWI IPLMIAIAVA LPFFSNSYLL       120
     GVVILGLIYV LLGLGLNIVV GLAGLLDLGY VAFYAIGAYG LALGYQYLGL GFWTVLPLAA       180
     ITAGLAGCIL GFPVLRLHGD YLAIVTLGFG EIIRLVLNNW LSLTGGPNGM PAPLPTFFGL       240
     EFGKRAKDGG VPFHEFFGIA YNPDVKYYFI YAVLFLVVLA VLYIKHRLVK MPVGRAWEAL       300
     REDEIACRSM GLNHVLVKLS AFTIGASTAG LAGVFFATYQ GFVNPTSFTF FESALILAIV       360
     VLGGMGSTIG VVIAAFVLTV APELLRGFAE YRVLLFGILM VLMMIWRPRG LIRISRTGVT       420
     PRKGAIHYER TAP                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page