(data stored in ACNUC7421 zone)

EMBL: CP000094.PE553

CP000094.PE553       Location/Qualifiers
FT   CDS             649323..650195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0555"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72299"
FT                   /db_xref="GOA:Q3KIV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV7"
FT                   /protein_id="ABA72299.1"
FT                   /translation="MSEVVLSVEKLMMHFGGIKALSDVSLKVKRNSIFALIGPNGAGKT
FT                   TVFNCLTGFYKASGGKIELNVRGQQTNVIQLLGESFKPTDFVSPKNFASRLYYKMFGGT
FT                   HLVNRAGLARTFQNIRLFKEMSVLENLLVAQHMWVNRNMLAGILNTKGYRKAESDALDC
FT                   AFYWLEVVDLVDCANRLAGELSYGQQRRLEIARAMCTRPQIICLDEPAAGLNPQETEAL
FT                   SAMIRLLRDEHDLTVVLIEHDMGMVMSISDHIVVLDHGIVIAEGGPDAIRNDPKVIAAY
FT                   LGADEEEVV"
     MSEVVLSVEK LMMHFGGIKA LSDVSLKVKR NSIFALIGPN GAGKTTVFNC LTGFYKASGG        60
     KIELNVRGQQ TNVIQLLGES FKPTDFVSPK NFASRLYYKM FGGTHLVNRA GLARTFQNIR       120
     LFKEMSVLEN LLVAQHMWVN RNMLAGILNT KGYRKAESDA LDCAFYWLEV VDLVDCANRL       180
     AGELSYGQQR RLEIARAMCT RPQIICLDEP AAGLNPQETE ALSAMIRLLR DEHDLTVVLI       240
     EHDMGMVMSI SDHIVVLDHG IVIAEGGPDA IRNDPKVIAA YLGADEEEVV                  290
//

If you have problems or comments...

PBIL Back to PBIL home page