(data stored in ACNUC7421 zone)

EMBL: CP000094.PE554

CP000094.PE554       Location/Qualifiers
FT   CDS             650192..650908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0556"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72300"
FT                   /db_xref="GOA:Q3KIV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV6"
FT                   /protein_id="ABA72300.1"
FT                   /translation="MTQPILELKDLDVFYGPIQALKGVSLQINEGETVSLIGSNGAGKS
FT                   TLLMSIFGQPRAAGGQILYQGVDITHKSSHYIASNGIAQSPEGRRVFPDMTVEENLLMG
FT                   TIPIGDKYAKEDMQRMFELFPRLEERRNQRAMTMSGGEQQMLAIARALMSRPKLLLLDE
FT                   PSLGLAPIVVKQIFATLRELAKTGMTIFLVEQNANHALKLSDRAYVMVNGEIRLTGTGQ
FT                   ELLVNEEVRNAYLGGH"
     MTQPILELKD LDVFYGPIQA LKGVSLQINE GETVSLIGSN GAGKSTLLMS IFGQPRAAGG        60
     QILYQGVDIT HKSSHYIASN GIAQSPEGRR VFPDMTVEEN LLMGTIPIGD KYAKEDMQRM       120
     FELFPRLEER RNQRAMTMSG GEQQMLAIAR ALMSRPKLLL LDEPSLGLAP IVVKQIFATL       180
     RELAKTGMTI FLVEQNANHA LKLSDRAYVM VNGEIRLTGT GQELLVNEEV RNAYLGGH         238
//

If you have problems or comments...

PBIL Back to PBIL home page