(data stored in ACNUC7421 zone)

EMBL: CP000094.PE556

CP000094.PE556       Location/Qualifiers
FT   CDS             652542..653447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0558"
FT                   /product="putative cation transport-related membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72302"
FT                   /db_xref="GOA:Q3KIV4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV4"
FT                   /protein_id="ABA72302.1"
FT                   /translation="MSNRGEQSLLKQSTILMFAVSIAGIATGFVSGSQSILFDGFFSLI
FT                   ATFIKVLMLITAKLIAKQSNQRFQFGFWHLEPMVLLIEGSFLLLIAIYAFLNGVFGIIN
FT                   GGREIELGLVIIYAAVFTVVEFAYFFYVRHRNRKFKSSLIQFDNISWLVDAMLSVGLLI
FT                   SFLAALLLKSQGYGEWAKFVDPLILIVLALTMLPPAFKILGPALRDVLGIAPDTLDDQV
FT                   RQVMDAAKVEHGFDDYVSYVQKHGRARFIEIHVVLPANYRLQSVGQLDVLREEISAKLG
FT                   KPDAARWLTISFTGDRKWIA"
     MSNRGEQSLL KQSTILMFAV SIAGIATGFV SGSQSILFDG FFSLIATFIK VLMLITAKLI        60
     AKQSNQRFQF GFWHLEPMVL LIEGSFLLLI AIYAFLNGVF GIINGGREIE LGLVIIYAAV       120
     FTVVEFAYFF YVRHRNRKFK SSLIQFDNIS WLVDAMLSVG LLISFLAALL LKSQGYGEWA       180
     KFVDPLILIV LALTMLPPAF KILGPALRDV LGIAPDTLDD QVRQVMDAAK VEHGFDDYVS       240
     YVQKHGRARF IEIHVVLPAN YRLQSVGQLD VLREEISAKL GKPDAARWLT ISFTGDRKWI       300
     A                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page