(data stored in ACNUC7421 zone)

EMBL: CP000094.PE558

CP000094.PE558       Location/Qualifiers
FT   CDS             complement(654721..655293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0560"
FT                   /product="putative urease/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72304"
FT                   /db_xref="GOA:Q3KIV2"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV2"
FT                   /protein_id="ABA72304.1"
FT                   /translation="MTLKRILGAVALLLTPALAFAHPGHGDSGLVAGISHPIGGLDHLL
FT                   AMVAVGLWAAQQQGAARWALPCTFVGTMLIGGLLGFEGLELPALESGIAASVLALGLAV
FT                   ALAVRPPLVMAVAATALFALFHGVAHGLELPDMSSPWAYAAGFVVATAALHAAGYAVVR
FT                   FLPQAAAPLVRLAGTASAVTGAWLLAG"
     MTLKRILGAV ALLLTPALAF AHPGHGDSGL VAGISHPIGG LDHLLAMVAV GLWAAQQQGA        60
     ARWALPCTFV GTMLIGGLLG FEGLELPALE SGIAASVLAL GLAVALAVRP PLVMAVAATA       120
     LFALFHGVAH GLELPDMSSP WAYAAGFVVA TAALHAAGYA VVRFLPQAAA PLVRLAGTAS       180
     AVTGAWLLAG                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page