(data stored in ACNUC7421 zone)

EMBL: CP000094.PE559

CP000094.PE559       Location/Qualifiers
FT   CDS             complement(655321..655935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0561"
FT                   /product="urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72305"
FT                   /db_xref="GOA:Q3KIV1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIV1"
FT                   /protein_id="ABA72305.1"
FT                   /translation="MNTQPLRVGIGGPVGSGKTALTLALCLALRERYNLAVVTNDIYTR
FT                   EDADFLVRNEALAPERIIGVETGGCPHTAIREDASINLEAVDQLNRRFPGLDLILVESG
FT                   GDNLSATFSPELSDLTIYVIDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLEM
FT                   MNSDTQRMRNGKPFVFSNQKTGQGLEEIIAFIERQGLLTAA"
     MNTQPLRVGI GGPVGSGKTA LTLALCLALR ERYNLAVVTN DIYTREDADF LVRNEALAPE        60
     RIIGVETGGC PHTAIREDAS INLEAVDQLN RRFPGLDLIL VESGGDNLSA TFSPELSDLT       120
     IYVIDVSAGD KLPRKGGPGI CKSDLLVINK IDLAPLVGAS LEMMNSDTQR MRNGKPFVFS       180
     NQKTGQGLEE IIAFIERQGL LTAA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page