(data stored in ACNUC7421 zone)

EMBL: CP000094.PE563

CP000094.PE563       Location/Qualifiers
FT   CDS             complement(658140..658604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU7"
FT                   /protein_id="ABA72309.1"
FT                   /translation="MKRQLLFSLTLSMLASTAFALPAADQATPQVKTSHSVFSQTVAAD
FT                   GSDRTPQGQTLAENGRNRLEEKGLVQDGYDKTPQGQTVAEGGRDRLEEKGLVQDGSDRT
FT                   PQGQTLASDGGDRTPQGQTLAADGYDKTPQGQTLAEGGGDRVIERNSALS"
     MKRQLLFSLT LSMLASTAFA LPAADQATPQ VKTSHSVFSQ TVAADGSDRT PQGQTLAENG        60
     RNRLEEKGLV QDGYDKTPQG QTVAEGGRDR LEEKGLVQDG SDRTPQGQTL ASDGGDRTPQ       120
     GQTLAADGYD KTPQGQTLAE GGGDRVIERN SALS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page