(data stored in ACNUC7421 zone)

EMBL: CP000094.PE564

CP000094.PE564       Location/Qualifiers
FT   CDS             658986..661061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0566"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72310"
FT                   /db_xref="GOA:Q3KIU6"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU6"
FT                   /protein_id="ABA72310.1"
FT                   /translation="MTRTRKIFVWTFATLVLLLAVLVLIIVFFDWNRIKPPLNAKVSEE
FT                   LHRPFAINGNLSVVWRRELDEGGWRAWVPWPHVVAEDLTLGNPDWSKQPQMVTLKRVEL
FT                   RISPLALLAQRVAIPRIDLTEPNAQLQRLADGRANWTFKFDPKDPNAEPSNWVVDIGAI
FT                   GFDKGHVTLDDQTLKTNLNLLIDPLGKPIPFSDIVGDKAAKTAQDKGGAPQDYAFGLKV
FT                   TGQYHGQKLAGQGKIGGLLALQDASKPFPLQAQAKIGDTSVELAGTLTDPLNLGALDLR
FT                   LKLAGASLGNLYPLTGVTLPDTPPYATDGHLIAKLHEPDGAQFRYEQFNGKIGSSDIHG
FT                   DLAYVASQPRPKLSGALLSNQLLFADLAPLIGADSNAKQKARGGESKQPADKVLPVEEF
FT                   KTERWRDMDADVEFTGKRIVHSEELPFTDLYTHLKLNDGELSLEPLRFGVAGGNLDAQI
FT                   RLNGRTEPLEGRARLTARKFKLKQLFPTFEPMKTSFGELNGDADIAGRGNSVAKLLGGA
FT                   NGNLKMLINDGAISRELMELAGLNVGNYVVGKIFGDKEVKINCAAADFDIKTGLATTRL
FT                   FVFDTENAIIYIDGTANMATEQLDLTVTPESKGWRLISLRSPLYVRGKFIKPDAGVKAV
FT                   PLMLRGAGMVALGVIAAPAAGLLALVAPSGGEPNQCAPLLEQMKAGKAPATVKPTK"
     MTRTRKIFVW TFATLVLLLA VLVLIIVFFD WNRIKPPLNA KVSEELHRPF AINGNLSVVW        60
     RRELDEGGWR AWVPWPHVVA EDLTLGNPDW SKQPQMVTLK RVELRISPLA LLAQRVAIPR       120
     IDLTEPNAQL QRLADGRANW TFKFDPKDPN AEPSNWVVDI GAIGFDKGHV TLDDQTLKTN       180
     LNLLIDPLGK PIPFSDIVGD KAAKTAQDKG GAPQDYAFGL KVTGQYHGQK LAGQGKIGGL       240
     LALQDASKPF PLQAQAKIGD TSVELAGTLT DPLNLGALDL RLKLAGASLG NLYPLTGVTL       300
     PDTPPYATDG HLIAKLHEPD GAQFRYEQFN GKIGSSDIHG DLAYVASQPR PKLSGALLSN       360
     QLLFADLAPL IGADSNAKQK ARGGESKQPA DKVLPVEEFK TERWRDMDAD VEFTGKRIVH       420
     SEELPFTDLY THLKLNDGEL SLEPLRFGVA GGNLDAQIRL NGRTEPLEGR ARLTARKFKL       480
     KQLFPTFEPM KTSFGELNGD ADIAGRGNSV AKLLGGANGN LKMLINDGAI SRELMELAGL       540
     NVGNYVVGKI FGDKEVKINC AAADFDIKTG LATTRLFVFD TENAIIYIDG TANMATEQLD       600
     LTVTPESKGW RLISLRSPLY VRGKFIKPDA GVKAVPLMLR GAGMVALGVI AAPAAGLLAL       660
     VAPSGGEPNQ CAPLLEQMKA GKAPATVKPT K                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page