(data stored in ACNUC7421 zone)

EMBL: CP000094.PE57

CP000094.PE57        Location/Qualifiers
FT   CDS             63929..64225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71801"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA5"
FT                   /protein_id="ABA71801.1"
FT                   /translation="MRTLNRLLLVSLIAVSPLAAIAADDAPSSEPEVTISTHTEGDKVI
FT                   QEYSRSGFVYAIKVTPKGGKPYFLVRADGTDANYIRSDQPDMLIPSWEIFTWK"
     MRTLNRLLLV SLIAVSPLAA IAADDAPSSE PEVTISTHTE GDKVIQEYSR SGFVYAIKVT        60
     PKGGKPYFLV RADGTDANYI RSDQPDMLIP SWEIFTWK                                98
//

If you have problems or comments...

PBIL Back to PBIL home page