(data stored in ACNUC7421 zone)

EMBL: CP000094.PE570

CP000094.PE570       Location/Qualifiers
FT   CDS             complement(664737..665630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0572"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72316"
FT                   /db_xref="GOA:Q3KIU0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU0"
FT                   /protein_id="ABA72316.1"
FT                   /translation="MQYAFPLLAIFIWAGNTVINKLAVGAIFPAEIGFYRWLLAGLLFT
FT                   PFMLKKVIAHWPQIRPNLGKIFILGVLGMAVYQSLAYFAATLTSATNMGIILSLMPLMS
FT                   LAMAIISLGQQLTAGALVGAVLSFAGVLVVVSSGSLGALLQHGVNLGDAMMLIATLAYA
FT                   IYSTLLKKWQLRLPPLVLLYLQVLVAVVVLFPLYAASPKTGLTLQNIPLVLYACLLASM
FT                   LAPLAWMQAVQRLGPSRTTLFFNLLPLITALIAAVVLKEQLALYHLVGGLLTLGGVILS
FT                   ERWTTVLGRSRTPSAA"
     MQYAFPLLAI FIWAGNTVIN KLAVGAIFPA EIGFYRWLLA GLLFTPFMLK KVIAHWPQIR        60
     PNLGKIFILG VLGMAVYQSL AYFAATLTSA TNMGIILSLM PLMSLAMAII SLGQQLTAGA       120
     LVGAVLSFAG VLVVVSSGSL GALLQHGVNL GDAMMLIATL AYAIYSTLLK KWQLRLPPLV       180
     LLYLQVLVAV VVLFPLYAAS PKTGLTLQNI PLVLYACLLA SMLAPLAWMQ AVQRLGPSRT       240
     TLFFNLLPLI TALIAAVVLK EQLALYHLVG GLLTLGGVIL SERWTTVLGR SRTPSAA          297
//

If you have problems or comments...

PBIL Back to PBIL home page