(data stored in ACNUC7421 zone)

EMBL: CP000094.PE574

CP000094.PE574       Location/Qualifiers
FT   CDS             complement(668400..669674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0576"
FT                   /product="putative chaperone/heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72320"
FT                   /db_xref="GOA:Q3KIT6"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT6"
FT                   /protein_id="ABA72320.1"
FT                   /translation="MKDASPARACGIDFGTSNSTVGWLRPGMETMIALEDDKITLPSVV
FT                   FFNIEERRPVYGRLALHEYLEGYEGRLMRSLKSLLGSKLIKHDTSVLGTAMPFKDLLGL
FT                   FIGQLKSRAEAAAGREFEQVVLGRPVFFVDDDPLADQEAEDTLVEVARKLGFKDVSFQY
FT                   EPIAAAFDYESTIEKEELVLIVDIGGGTSDFSLVRLSPERRGVDNRHDDILATGGVHIG
FT                   GTDFDKQLSLQGLMPLFGYGSRMKSGAFMPTSHHMNLATWHTINSVYSQKSTLALGSMR
FT                   YDIEDTGGIDRLFKLIEQRAGHWLAMEVEETKIHLTHNDSRHVPLDRIEPGLSVELTRA
FT                   LFESAIESQLERVRGSVTQLLADANVAVGQVDTVFFTGGSSGIPALRNSVSAMLPNARH
FT                   VEGNIFGSIGSGLAIEAMKRYGSVN"
     MKDASPARAC GIDFGTSNST VGWLRPGMET MIALEDDKIT LPSVVFFNIE ERRPVYGRLA        60
     LHEYLEGYEG RLMRSLKSLL GSKLIKHDTS VLGTAMPFKD LLGLFIGQLK SRAEAAAGRE       120
     FEQVVLGRPV FFVDDDPLAD QEAEDTLVEV ARKLGFKDVS FQYEPIAAAF DYESTIEKEE       180
     LVLIVDIGGG TSDFSLVRLS PERRGVDNRH DDILATGGVH IGGTDFDKQL SLQGLMPLFG       240
     YGSRMKSGAF MPTSHHMNLA TWHTINSVYS QKSTLALGSM RYDIEDTGGI DRLFKLIEQR       300
     AGHWLAMEVE ETKIHLTHND SRHVPLDRIE PGLSVELTRA LFESAIESQL ERVRGSVTQL       360
     LADANVAVGQ VDTVFFTGGS SGIPALRNSV SAMLPNARHV EGNIFGSIGS GLAIEAMKRY       420
     GSVN                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page