(data stored in ACNUC7421 zone)

EMBL: CP000094.PE575

CP000094.PE575       Location/Qualifiers
FT   CDS             669968..670918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0577"
FT                   /product="curved DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72321"
FT                   /db_xref="GOA:Q3KIT5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT5"
FT                   /protein_id="ABA72321.1"
FT                   /translation="MDFKDYYKILGVEPTADDKAIKAAYRKLARKYHPDVSKEKDAEAK
FT                   FKDASEAYEALKSADKRAEYDELRRYGQHGQPFQGPPGWQSRGGFGGGGGDTGDFSDFF
FT                   SSIFGNRGPGFGGGAGRQSRSAGRRGQDVELELPIFLEETLSNESKKISFQVPQYNGSG
FT                   QHVSNTSKSLNVKIPAGVTDGERIRLKGQGAPGIGGGANGDLYLTIRFAPHPKFDVEGE
FT                   NLIITLPLAPWELALGAEVAVPTLTGKINLKVPAGSQNGQRMRAKGHGLQNKAGERGYL
FT                   FVQLKAVMPKANGDDVKALWQELAKKAAFNPRENF"
     MDFKDYYKIL GVEPTADDKA IKAAYRKLAR KYHPDVSKEK DAEAKFKDAS EAYEALKSAD        60
     KRAEYDELRR YGQHGQPFQG PPGWQSRGGF GGGGGDTGDF SDFFSSIFGN RGPGFGGGAG       120
     RQSRSAGRRG QDVELELPIF LEETLSNESK KISFQVPQYN GSGQHVSNTS KSLNVKIPAG       180
     VTDGERIRLK GQGAPGIGGG ANGDLYLTIR FAPHPKFDVE GENLIITLPL APWELALGAE       240
     VAVPTLTGKI NLKVPAGSQN GQRMRAKGHG LQNKAGERGY LFVQLKAVMP KANGDDVKAL       300
     WQELAKKAAF NPRENF                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page