(data stored in ACNUC7421 zone)

EMBL: CP000094.PE576

CP000094.PE576       Location/Qualifiers
FT   CDS             670942..671247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT4"
FT                   /protein_id="ABA72322.1"
FT                   /translation="MSSPLMVQLDMAEFCEAADLSDVYVIEIVEHGILEPQGTQPREWR
FT                   FTDYELALAKRAAKLRRDLELEWEGVALALDLLEEVQELRAENRMLRQRLARLVVE"
     MSSPLMVQLD MAEFCEAADL SDVYVIEIVE HGILEPQGTQ PREWRFTDYE LALAKRAAKL        60
     RRDLELEWEG VALALDLLEE VQELRAENRM LRQRLARLVV E                           101
//

If you have problems or comments...

PBIL Back to PBIL home page