(data stored in ACNUC7421 zone)

EMBL: CP000094.PE582

CP000094.PE582       Location/Qualifiers
FT   CDS             complement(675799..676101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0584"
FT                   /product="urease gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72328"
FT                   /db_xref="GOA:Q3KIS8"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIS8"
FT                   /protein_id="ABA72328.1"
FT                   /translation="MDLTPREKDKLLIFTAGLVAERRLARGVKLNYPEAMAYISAALLE
FT                   GARDGQTVAELMHYGTTLLTREQVMEGIPEMIPEIQVEATFPDGTKLVTVHQPIV"
     MDLTPREKDK LLIFTAGLVA ERRLARGVKL NYPEAMAYIS AALLEGARDG QTVAELMHYG        60
     TTLLTREQVM EGIPEMIPEI QVEATFPDGT KLVTVHQPIV                             100
//

If you have problems or comments...

PBIL Back to PBIL home page