(data stored in ACNUC7421 zone)

EMBL: CP000094.PE584

CP000094.PE584       Location/Qualifiers
FT   CDS             complement(677005..677703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0586"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72330"
FT                   /db_xref="GOA:Q3KIS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS6"
FT                   /protein_id="ABA72330.1"
FT                   /translation="MLQVDKLHQYYGGSHILRGLSFDVKVGEVTCLLGRNGVGKTTLLK
FT                   CLMGLLPAKEGAVNWEGQPITTYKPHQRVHAGIAYVPQGREIFGRLTVEENLLMGLSRF
FT                   PGSEAKEVPAFIYELFPVLLQMKQRRGGDLSGGQQQQLAIGRALASRPRLLILDEPTEG
FT                   IQPSVIKEIGAVIKKLAARGDMAILLVEQFYDFAAELADQYLVMSRGEIVQQGRGENME
FT                   SEGVRGLVTI"
     MLQVDKLHQY YGGSHILRGL SFDVKVGEVT CLLGRNGVGK TTLLKCLMGL LPAKEGAVNW        60
     EGQPITTYKP HQRVHAGIAY VPQGREIFGR LTVEENLLMG LSRFPGSEAK EVPAFIYELF       120
     PVLLQMKQRR GGDLSGGQQQ QLAIGRALAS RPRLLILDEP TEGIQPSVIK EIGAVIKKLA       180
     ARGDMAILLV EQFYDFAAEL ADQYLVMSRG EIVQQGRGEN MESEGVRGLV TI               232
//

If you have problems or comments...

PBIL Back to PBIL home page