(data stored in ACNUC7421 zone)

EMBL: CP000094.PE586

CP000094.PE586       Location/Qualifiers
FT   CDS             complement(678707..679786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0588"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72332"
FT                   /db_xref="GOA:Q3KIS4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS4"
FT                   /protein_id="ABA72332.1"
FT                   /translation="MNQPLLVTATQKAGPKVTLAVGVVVLALLIALPLLSLLPADSALH
FT                   VSAYTLTLVGKILCYAIVALALDLVWGYAGLLSLGHGLFFALGGYAMGMYLMRQAAGDG
FT                   LPAFMTFLSWTELPWYWSGTGSFLWAMCLVVLAPGLLALVFGFFAFRSRIKGVYFSIMT
FT                   QALTFAGMLLFFRNETGFGGNNGFTNFRTILGFGITEPGTRAVLFLATVLLLVASLFIG
FT                   WRLARSKFGRVLTALRDAENRLMFCGYDPRGFKLFVWVLSAVLCGLAGALYVPQVGIIN
FT                   PSEMSPTNSIEAAVWVALGGRGTLIGPLLGAGVVNGMKSWFTVAFPEYWLFFLGALFIV
FT                   VTLYLPKGVIGLLKKRGES"
     MNQPLLVTAT QKAGPKVTLA VGVVVLALLI ALPLLSLLPA DSALHVSAYT LTLVGKILCY        60
     AIVALALDLV WGYAGLLSLG HGLFFALGGY AMGMYLMRQA AGDGLPAFMT FLSWTELPWY       120
     WSGTGSFLWA MCLVVLAPGL LALVFGFFAF RSRIKGVYFS IMTQALTFAG MLLFFRNETG       180
     FGGNNGFTNF RTILGFGITE PGTRAVLFLA TVLLLVASLF IGWRLARSKF GRVLTALRDA       240
     ENRLMFCGYD PRGFKLFVWV LSAVLCGLAG ALYVPQVGII NPSEMSPTNS IEAAVWVALG       300
     GRGTLIGPLL GAGVVNGMKS WFTVAFPEYW LFFLGALFIV VTLYLPKGVI GLLKKRGES        359
//

If you have problems or comments...

PBIL Back to PBIL home page