(data stored in ACNUC7421 zone)

EMBL: CP000094.PE587

CP000094.PE587       Location/Qualifiers
FT   CDS             complement(679786..681288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0589"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72333"
FT                   /db_xref="GOA:Q3KIS3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS3"
FT                   /protein_id="ABA72333.1"
FT                   /translation="MPTALYRLILAVALLLPMAVHAGDAEDFVAANPMQQAKLLEAWAA
FT                   QPDPARGELINALQQGELTVDGQPKTLRLNNRLRGLIDTALASHQLLAADAKTRLTAAQ
FT                   QLQKSAKPAQLKFLDRQLAGEIDESVHAALSLALANLQLVDTDPAVRLAAVRLLGETGD
FT                   PLARTRLEGLLEPGIETDANVRTAAETSLAQVKRKLLVGELLGQAFSGMSLGSILLLAA
FT                   LGLAITFGLLGVINMAHGEMLMLGAYSTYVVQLMFQRYAPQAIEFYPLIALPVAFFVTA
FT                   AIGMALERTVIRHLYGRPLETLLATWGISLMLIQLVRLVFGAQNVEVANPAWLSGGIQV
FT                   LPNLVLPYNRIVIIAFALFVVVLTWLLLNKTRLGLNVRAVTQNRNMAACCGVPTGRVDM
FT                   LAFGLGSGIAGLGGVALSQIGNVGPDLGQSYIIDSFLVVVLGGVGQLAGSVFAAFGLGI
FT                   ANKILEPQIGAVLGKILILALIILFIQKRPQGLFALKGRVID"
     MPTALYRLIL AVALLLPMAV HAGDAEDFVA ANPMQQAKLL EAWAAQPDPA RGELINALQQ        60
     GELTVDGQPK TLRLNNRLRG LIDTALASHQ LLAADAKTRL TAAQQLQKSA KPAQLKFLDR       120
     QLAGEIDESV HAALSLALAN LQLVDTDPAV RLAAVRLLGE TGDPLARTRL EGLLEPGIET       180
     DANVRTAAET SLAQVKRKLL VGELLGQAFS GMSLGSILLL AALGLAITFG LLGVINMAHG       240
     EMLMLGAYST YVVQLMFQRY APQAIEFYPL IALPVAFFVT AAIGMALERT VIRHLYGRPL       300
     ETLLATWGIS LMLIQLVRLV FGAQNVEVAN PAWLSGGIQV LPNLVLPYNR IVIIAFALFV       360
     VVLTWLLLNK TRLGLNVRAV TQNRNMAACC GVPTGRVDML AFGLGSGIAG LGGVALSQIG       420
     NVGPDLGQSY IIDSFLVVVL GGVGQLAGSV FAAFGLGIAN KILEPQIGAV LGKILILALI       480
     ILFIQKRPQG LFALKGRVID                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page