(data stored in ACNUC7421 zone)

EMBL: CP000094.PE593

CP000094.PE593       Location/Qualifiers
FT   CDS             complement(687960..689339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0595"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72339"
FT                   /db_xref="GOA:Q3KIR7"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR7"
FT                   /protein_id="ABA72339.1"
FT                   /translation="MKQPKPNFYNLAWRWHFYAGLFVAPFMVMLALTGIIYLFKPQLDS
FT                   LMYSSLLNVPAGHHTVPADDLLQKVKSAYPQGQVTQYLPPVNAERSAQFVVANAGHELN
FT                   VFVDPYHGDILGEQDAKQNLQAIARAIHGELMIGTVGDRLIEMAAGWGVVLVVSGVFLW
FT                   WPRGQAAGILWPRLSSRGRVLWRDLHAVTGFWGAALLLVMLLSGMTWTGFWGKQYAQVW
FT                   NVFPAAMWDNVPTSDVEAGSLNNAARQTVPWAMENTPMPMSGDHAEHMAHGGMQHGPAA
FT                   PTIRLQDVQNIAVERKVEPGYSITMPTTATGVFTIAVFADDPRNDATLHVDQYTGKVLA
FT                   DVRFEQYGAVARATEIGVMLHEGKMFGTFNQIIVLLICLMILLSAVSGVVIWWKRRPQG
FT                   KFGVPPLRHDLPKWKTGVAIMLVLAVVFPLVGASLVVVWLLDRLLLSRLARQTESASTS
FT                   S"
     MKQPKPNFYN LAWRWHFYAG LFVAPFMVML ALTGIIYLFK PQLDSLMYSS LLNVPAGHHT        60
     VPADDLLQKV KSAYPQGQVT QYLPPVNAER SAQFVVANAG HELNVFVDPY HGDILGEQDA       120
     KQNLQAIARA IHGELMIGTV GDRLIEMAAG WGVVLVVSGV FLWWPRGQAA GILWPRLSSR       180
     GRVLWRDLHA VTGFWGAALL LVMLLSGMTW TGFWGKQYAQ VWNVFPAAMW DNVPTSDVEA       240
     GSLNNAARQT VPWAMENTPM PMSGDHAEHM AHGGMQHGPA APTIRLQDVQ NIAVERKVEP       300
     GYSITMPTTA TGVFTIAVFA DDPRNDATLH VDQYTGKVLA DVRFEQYGAV ARATEIGVML       360
     HEGKMFGTFN QIIVLLICLM ILLSAVSGVV IWWKRRPQGK FGVPPLRHDL PKWKTGVAIM       420
     LVLAVVFPLV GASLVVVWLL DRLLLSRLAR QTESASTSS                              459
//

If you have problems or comments...

PBIL Back to PBIL home page