(data stored in ACNUC7421 zone)

EMBL: CP000094.PE594

CP000094.PE594       Location/Qualifiers
FT   CDS             complement(689419..691551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0596"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72340"
FT                   /db_xref="GOA:Q3KIR6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR6"
FT                   /protein_id="ABA72340.1"
FT                   /translation="MEIVMSRFSAVPRPASAPASFALNESRVRFRHATAVLCGVLLSPL
FT                   VHADEHAGHADELSPTVITAIAPSSPLTIVTNPKDPRQPVPASDGGDYLKTIPGFALVR
FT                   NGGTNGDPVLRGMFGSRLNILTNGSMMLGACPGRMDAPTSYISPETYDKLTVIKGPQTV
FT                   LYGPGASAGTILFDREPESFGELGTRVNASVLAGSHGRFDKVVDAAAGGSLGYVRVIGN
FT                   TAHSDDYRDGNNDIVASRYDKWNGDVALGWTPDADTLIELTAGKGDGEARYAGRGMDGS
FT                   QFLRESLGLRVEKSNITDVLEKLEAQIYYNYADHVMDNYTLRTPSGTGMMAGPMASNVD
FT                   RRTLGARIKATWRWADIQLITGLDAQTNEHRQRSGMGIDTYKDQPYTKDADFHNYGVFS
FT                   EMTWYAADRDRLITGARVDRASARDFRQTTGSGMMSRPNPTAGDTRADTLPSGFVRYEH
FT                   DLADSPTTLYAGLGHAQRFPDYWELFSPKSGPAGSVNAFDSIKPEKTTQLDFGVNYKDA
FT                   NLEAWASGYIGVVRDYILFDYTPTMMGMSTSRAENIDARIMGGELGAAYKLTDNWKADA
FT                   TLAYAWGKNSSDGKALPQMPPLDARFGLTYSEDNWSAGALWRVVAAQNRIDQNKGNVVG
FT                   KDYDKSSGFGVFSLNGAYRINKHWKVSTGVDNLFGKAYAEHLNLAGNAGFGYPANDPQA
FT                   INEPGRTLWTKVDMSF"
     MEIVMSRFSA VPRPASAPAS FALNESRVRF RHATAVLCGV LLSPLVHADE HAGHADELSP        60
     TVITAIAPSS PLTIVTNPKD PRQPVPASDG GDYLKTIPGF ALVRNGGTNG DPVLRGMFGS       120
     RLNILTNGSM MLGACPGRMD APTSYISPET YDKLTVIKGP QTVLYGPGAS AGTILFDREP       180
     ESFGELGTRV NASVLAGSHG RFDKVVDAAA GGSLGYVRVI GNTAHSDDYR DGNNDIVASR       240
     YDKWNGDVAL GWTPDADTLI ELTAGKGDGE ARYAGRGMDG SQFLRESLGL RVEKSNITDV       300
     LEKLEAQIYY NYADHVMDNY TLRTPSGTGM MAGPMASNVD RRTLGARIKA TWRWADIQLI       360
     TGLDAQTNEH RQRSGMGIDT YKDQPYTKDA DFHNYGVFSE MTWYAADRDR LITGARVDRA       420
     SARDFRQTTG SGMMSRPNPT AGDTRADTLP SGFVRYEHDL ADSPTTLYAG LGHAQRFPDY       480
     WELFSPKSGP AGSVNAFDSI KPEKTTQLDF GVNYKDANLE AWASGYIGVV RDYILFDYTP       540
     TMMGMSTSRA ENIDARIMGG ELGAAYKLTD NWKADATLAY AWGKNSSDGK ALPQMPPLDA       600
     RFGLTYSEDN WSAGALWRVV AAQNRIDQNK GNVVGKDYDK SSGFGVFSLN GAYRINKHWK       660
     VSTGVDNLFG KAYAEHLNLA GNAGFGYPAN DPQAINEPGR TLWTKVDMSF                  710
//

If you have problems or comments...

PBIL Back to PBIL home page