(data stored in ACNUC7421 zone)

EMBL: CP000094.PE6

CP000094.PE6         Location/Qualifiers
FT   CDS             7716..9257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0006"
FT                   /product="putative two component system, histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71750"
FT                   /db_xref="GOA:Q3KKF6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKF6"
FT                   /protein_id="ABA71750.1"
FT                   /translation="MNNQRRHESRVPSQVQRLFRQLVREWVWISLVLLPLTALLSWRAQ
FT                   INLHDPVPLMGAGLSVAMVACVLGLLLWRPRLALWLTLGGIACVLLTSAGLAETRRWWS
FT                   PTPAALGMLFGYLIWNWRRLSVVLTYFGWELARLDSEPKVFPERRRAQFPSADRLQGQI
FT                   MALEQAMSRTRDTRRFIADGLEYLPVATLISDPRGEVLLGNRKARNLFDHTLVGEDVLD
FT                   QLASLGYPELSTEPRPPLSELPLLEFRDHKERSLRLERAALLPVDGDIPIGWLLSLTDL
FT                   SAERAAEEQRGVLLRFLSHDLRAPHSAILALLEVHRHQTGTDSPLFEQIERQVRRALEL
FT                   TDGFVLLARAESEAYQFQPSLFGMLVMDVLDQALPIAQQKLIELSSDMDEQSHERLIMA
FT                   DQGLLTRALFNLLENAIKYSPAGSTVDLRVSCHDDWLRCELIDQGKGIAAEELPDLFSQ
FT                   YRRFSSAQGIDGVGLGLSMVKAVVDHHGGRIECVSVVDRGTTFRLELPLIAEEQA"
     MNNQRRHESR VPSQVQRLFR QLVREWVWIS LVLLPLTALL SWRAQINLHD PVPLMGAGLS        60
     VAMVACVLGL LLWRPRLALW LTLGGIACVL LTSAGLAETR RWWSPTPAAL GMLFGYLIWN       120
     WRRLSVVLTY FGWELARLDS EPKVFPERRR AQFPSADRLQ GQIMALEQAM SRTRDTRRFI       180
     ADGLEYLPVA TLISDPRGEV LLGNRKARNL FDHTLVGEDV LDQLASLGYP ELSTEPRPPL       240
     SELPLLEFRD HKERSLRLER AALLPVDGDI PIGWLLSLTD LSAERAAEEQ RGVLLRFLSH       300
     DLRAPHSAIL ALLEVHRHQT GTDSPLFEQI ERQVRRALEL TDGFVLLARA ESEAYQFQPS       360
     LFGMLVMDVL DQALPIAQQK LIELSSDMDE QSHERLIMAD QGLLTRALFN LLENAIKYSP       420
     AGSTVDLRVS CHDDWLRCEL IDQGKGIAAE ELPDLFSQYR RFSSAQGIDG VGLGLSMVKA       480
     VVDHHGGRIE CVSVVDRGTT FRLELPLIAE EQA                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page