(data stored in ACNUC7421 zone)

EMBL: CP000094.PE600

CP000094.PE600       Location/Qualifiers
FT   CDS             complement(694234..695331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0602"
FT                   /product="putative cobalamin biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72346"
FT                   /db_xref="GOA:Q3KIR0"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIR0"
FT                   /protein_id="ABA72346.1"
FT                   /translation="MRDETAEQPAPLRSGLTTGSCATATSLAAARLLLGGVVADAVQIV
FT                   LPKGKQVQMRLEFCRLTKDGAEAGTIKDAGDDPDVTHGALLYSRVQLMAEPGIRFIAGK
FT                   GVGTVTRPGLVLPVGEPAINPVPRKMISDHLTLLAEETGYRGGFEVTVNVEGGEALALK
FT                   TMNPRLGILGGLSILGTSGIVRPFSCAAYIASIHQGIDVAKTNGFLHIAACTGNASEDT
FT                   MRRVYNLPEIALIEMGDFVGAVLKHLRKVPVDKLSLCGGFGKISKLAAGHMDLHSRHSS
FT                   IDLPQLAEWAAAIGADDTLQQAIRGANTSQQALAIASAAGVALGDEVCRHALEFARSVV
FT                   PAQVQVEVFAIDRQGGIVGHAGAFV"
     MRDETAEQPA PLRSGLTTGS CATATSLAAA RLLLGGVVAD AVQIVLPKGK QVQMRLEFCR        60
     LTKDGAEAGT IKDAGDDPDV THGALLYSRV QLMAEPGIRF IAGKGVGTVT RPGLVLPVGE       120
     PAINPVPRKM ISDHLTLLAE ETGYRGGFEV TVNVEGGEAL ALKTMNPRLG ILGGLSILGT       180
     SGIVRPFSCA AYIASIHQGI DVAKTNGFLH IAACTGNASE DTMRRVYNLP EIALIEMGDF       240
     VGAVLKHLRK VPVDKLSLCG GFGKISKLAA GHMDLHSRHS SIDLPQLAEW AAAIGADDTL       300
     QQAIRGANTS QQALAIASAA GVALGDEVCR HALEFARSVV PAQVQVEVFA IDRQGGIVGH       360
     AGAFV                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page