(data stored in ACNUC7421 zone)

EMBL: CP000094.PE602

CP000094.PE602       Location/Qualifiers
FT   CDS             696680..697978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0604"
FT                   /product="putative cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72348"
FT                   /db_xref="GOA:Q3KIQ8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ8"
FT                   /protein_id="ABA72348.1"
FT                   /translation="MSNAIRPSACPGLLRIVQALDGGICRIKLDGGSITADQADAVANA
FT                   AERFAGGAIEATNRGNLQIRGIGDQSAALIDSLLAAGLGPRTAAGDDVRNLMLSPAAGI
FT                   DRQMRFDTRPLAGQILETLQSHPRFHELSAKFAVQLDGGEALAMLKHPHDLWLSAFESG
FT                   ENTLLAFGLAGCPTERPLAAVALVDGHALVVAVLELFLDLARPEQTRMRHLLDECPAPL
FT                   FLEKLGQRISLKAAGDWQRAAGPEGLHLGIHPQPSAGQVYVGAAPPLGRLGPDMLRGAA
FT                   QLAITFGDGSLRFTPWQSLLLPNVRETDAVQVLDELGKLNLLTHVEEPLTHLIACTGAN
FT                   GCGKGLADTKHDARLLATLLPHAVDVHLSGCPRSCAAAHRAAVTLLAVGPGHYDLYFRD
FT                   AALPGFGALHAHNLTIEAAATLLAARSRSPLDA"
     MSNAIRPSAC PGLLRIVQAL DGGICRIKLD GGSITADQAD AVANAAERFA GGAIEATNRG        60
     NLQIRGIGDQ SAALIDSLLA AGLGPRTAAG DDVRNLMLSP AAGIDRQMRF DTRPLAGQIL       120
     ETLQSHPRFH ELSAKFAVQL DGGEALAMLK HPHDLWLSAF ESGENTLLAF GLAGCPTERP       180
     LAAVALVDGH ALVVAVLELF LDLARPEQTR MRHLLDECPA PLFLEKLGQR ISLKAAGDWQ       240
     RAAGPEGLHL GIHPQPSAGQ VYVGAAPPLG RLGPDMLRGA AQLAITFGDG SLRFTPWQSL       300
     LLPNVRETDA VQVLDELGKL NLLTHVEEPL THLIACTGAN GCGKGLADTK HDARLLATLL       360
     PHAVDVHLSG CPRSCAAAHR AAVTLLAVGP GHYDLYFRDA ALPGFGALHA HNLTIEAAAT       420
     LLAARSRSPL DA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page