(data stored in ACNUC7421 zone)

EMBL: CP000094.PE605

CP000094.PE605       Location/Qualifiers
FT   CDS             699328..701031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0607"
FT                   /product="putative precorrin-3B C17-methyltransferase,
FT                   cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72351"
FT                   /db_xref="GOA:Q3KIQ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ5"
FT                   /protein_id="ABA72351.1"
FT                   /translation="MTHSTPAIVILGQGALATARRLQQVYPAAKIHGLNGRVEGADLTY
FT                   SDFGATLRELYQQDTPIIALCAAGIVIRTLAPLLLEKGVEPPVLAVAEDGSAVVPLLGG
FT                   LGGVNVMAREIAAGLEVAAAITTSGELRFGTCLLNPPGGYALGDLEQGKRFVSDLLAGH
FT                   SVRIDGAAPWLEQAQLPEDPQAQRSIHVGSAARAANTSELLIYPRSVAVAVGSSVTDVP
FT                   GTLRDALQQAGVAIQSLACLVAADAQMASPALREAALELAVPLRFVAPANDIGELVRDA
FT                   VPGARIITTSRDIAIAVAEQPLDVSQIGRPRGRLAVIGLGPGAAELMVPAVKAELARAT
FT                   DVLGYETYVRMAGPFRDDQVQHCTDNREEMQRARHAFRLAAQGRSVIVVSSGDPGVFAM
FT                   AAAVLEALHESTDPAWHSVDLEILPGVSASLATAAQAGAPLGHDFCVMSLSDNLKPWSI
FT                   IEKRLDLAAEADLALAFYNPISRSRPWQLGRALEIVAQHRTSQTPVVLGRDIGRPGQTL
FT                   RVTTLGALTPDQVDMRTMVLIGSSTTCTFPRAEGGKWVYTPRWYGSKPAG"
     MTHSTPAIVI LGQGALATAR RLQQVYPAAK IHGLNGRVEG ADLTYSDFGA TLRELYQQDT        60
     PIIALCAAGI VIRTLAPLLL EKGVEPPVLA VAEDGSAVVP LLGGLGGVNV MAREIAAGLE       120
     VAAAITTSGE LRFGTCLLNP PGGYALGDLE QGKRFVSDLL AGHSVRIDGA APWLEQAQLP       180
     EDPQAQRSIH VGSAARAANT SELLIYPRSV AVAVGSSVTD VPGTLRDALQ QAGVAIQSLA       240
     CLVAADAQMA SPALREAALE LAVPLRFVAP ANDIGELVRD AVPGARIITT SRDIAIAVAE       300
     QPLDVSQIGR PRGRLAVIGL GPGAAELMVP AVKAELARAT DVLGYETYVR MAGPFRDDQV       360
     QHCTDNREEM QRARHAFRLA AQGRSVIVVS SGDPGVFAMA AAVLEALHES TDPAWHSVDL       420
     EILPGVSASL ATAAQAGAPL GHDFCVMSLS DNLKPWSIIE KRLDLAAEAD LALAFYNPIS       480
     RSRPWQLGRA LEIVAQHRTS QTPVVLGRDI GRPGQTLRVT TLGALTPDQV DMRTMVLIGS       540
     STTCTFPRAE GGKWVYTPRW YGSKPAG                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page