(data stored in ACNUC7421 zone)

EMBL: CP000094.PE608

CP000094.PE608       Location/Qualifiers
FT   CDS             complement(716093..716689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0610"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72354"
FT                   /db_xref="GOA:Q3KIQ2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ2"
FT                   /protein_id="ABA72354.1"
FT                   /translation="MLHVLFSVYLKMLVLYSPFFVLSCFISLTRGYSRKEQRRLAWKVA
FT                   VATLVSSVLLYLFGRVIFDVFGITVDAFRIGAGSVLFISALGMAQGKSAVQTDNVQQDV
FT                   TIVPLTIPLTVGPGTIGALLVMGVSQPHWDDKLFAIMSIALASFTVGVVLYLSNRIERI
FT                   LGDQGLQIVSRLMGLFVCALAAQIIFTGVKGYLVP"
     MLHVLFSVYL KMLVLYSPFF VLSCFISLTR GYSRKEQRRL AWKVAVATLV SSVLLYLFGR        60
     VIFDVFGITV DAFRIGAGSV LFISALGMAQ GKSAVQTDNV QQDVTIVPLT IPLTVGPGTI       120
     GALLVMGVSQ PHWDDKLFAI MSIALASFTV GVVLYLSNRI ERILGDQGLQ IVSRLMGLFV       180
     CALAAQIIFT GVKGYLVP                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page