(data stored in ACNUC7421 zone)

EMBL: CP000094.PE62

CP000094.PE62        Location/Qualifiers
FT   CDS             67529..68317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0062"
FT                   /product="high-affinity zinc ABC transport system, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71806"
FT                   /db_xref="GOA:Q3KKA0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA0"
FT                   /protein_id="ABA71806.1"
FT                   /translation="MADFLFYALLAGLALAVVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFLLDVSPTVAVTVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HEVRIDLMAYLFGDLLAISPTDLAWILGGSAAVLVLLVTLWRPLLAITVHEELARVEGL
FT                   SVAGLRMALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGM
FT                   LAVCGGLALSWFKDTPAGPSIVVTAAALFLLSFVLPRRGV"
     MADFLFYALL AGLALAVVAG PLGSFVVWRR MAYFGDTLSH AALLGVALGF LLDVSPTVAV        60
     TVGCLLLAVL LVTLQQRQPL ASDTLLGILA PSTLSLGLVV LSFMHEVRID LMAYLFGDLL       120
     AISPTDLAWI LGGSAAVLVL LVTLWRPLLA ITVHEELARV EGLSVAGLRM ALMLLIAVVI       180
     AVAMKIVGVL LITSLLIIPA AAAQRHARSP EQMALGASVL GMLAVCGGLA LSWFKDTPAG       240
     PSIVVTAAAL FLLSFVLPRR GV                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page