(data stored in ACNUC7421 zone)

EMBL: CP000094.PE67

CP000094.PE67        Location/Qualifiers
FT   CDS             73266..74039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0067"
FT                   /product="putative D-methionine ABC transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71811"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK95"
FT                   /protein_id="ABA71811.1"
FT                   /translation="MKKLIVALAAVAAFSAHADETLTVAATPVPHAEILEFVKPALAKE
FT                   GVDLKVKVFTDYVQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTSLVSVTGVHLEPLGA
FT                   YSSKFKKIEELPSGANVVIPNDATNGGRALLLLAKAGVITLKDPNNILSTVKDIAQNPK
FT                   DLKIRELEAATIPRVLTQVDLALINTNYALEAKLDPSKDALVIEGSDSPYVNILVSRAD
FT                   NKDSDAMKKLAAALHSPEVKKFITEKYKGAVLPAF"
     MKKLIVALAA VAAFSAHADE TLTVAATPVP HAEILEFVKP ALAKEGVDLK VKVFTDYVQP        60
     NVQVAEKRLD ANFFQHQPYL DEFNKAKGTS LVSVTGVHLE PLGAYSSKFK KIEELPSGAN       120
     VVIPNDATNG GRALLLLAKA GVITLKDPNN ILSTVKDIAQ NPKDLKIREL EAATIPRVLT       180
     QVDLALINTN YALEAKLDPS KDALVIEGSD SPYVNILVSR ADNKDSDAMK KLAAALHSPE       240
     VKKFITEKYK GAVLPAF                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page