(data stored in ACNUC7421 zone)

EMBL: CP000094.PE70

CP000094.PE70        Location/Qualifiers
FT   CDS             complement(75636..76271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0070"
FT                   /product="putative copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71814"
FT                   /db_xref="GOA:Q3KK92"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK92"
FT                   /protein_id="ABA71814.1"
FT                   /translation="MTRTQKTVFILVAVIALILGLTVNKVLSGKGQGDPTALIDAGIIL
FT                   LPQSRNLPDVTMTNQDGQPVTVNELKGKWSLLFFGYTFCPDICPTTLAQLRQIKSELPK
FT                   DAVDKLQIVLVSVDPNRDNPAQLKQYLGYFDPQFIGLTPKSIDELQKVANAVSIPFIPA
FT                   DTSKPNYTVDHSGNLAVIGPDGTQRGFIRAPLNNAKLVAQLPVMLNRK"
     MTRTQKTVFI LVAVIALILG LTVNKVLSGK GQGDPTALID AGIILLPQSR NLPDVTMTNQ        60
     DGQPVTVNEL KGKWSLLFFG YTFCPDICPT TLAQLRQIKS ELPKDAVDKL QIVLVSVDPN       120
     RDNPAQLKQY LGYFDPQFIG LTPKSIDELQ KVANAVSIPF IPADTSKPNY TVDHSGNLAV       180
     IGPDGTQRGF IRAPLNNAKL VAQLPVMLNR K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page