(data stored in ACNUC7421 zone)

EMBL: CP000094.PE72

CP000094.PE72        Location/Qualifiers
FT   CDS             complement(77155..78234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71816"
FT                   /db_xref="GOA:Q3KK90"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK90"
FT                   /protein_id="ABA71816.1"
FT                   /translation="MAKPGFRLALFATLLALIVVLLGAYTRLTHAGLGCPDWPGCYGFI
FT                   SVPKSEAQLAHAELHYPDSPVEAHKGWNEMIHRYFAGTLGLLISILAGRAWVNRRHPGQ
FT                   PLKLPLFLLAVVFAQAAFGMWTVTLKLWPQVVTGHLLGGFATLSLLFLLTLRLSGVLPA
FT                   LTVPKRLQYWATAGLLLVIGQIALGGWVSSNYAAVACIDFPTCHGQWLPPADFANGFHL
FT                   TQHIGPNYLGGQLDSDARTAIHLTHRIGALLVTVVLLGLAWQLKVVGMTRLAGLVLIAL
FT                   GAQITLGISNVLFHLPLPVAVAHNAGGAALLLTMVLVNYHARTSLVRVRQPMIARWRLS
FT                   PRKHSAAPITIKGETPWRF"
     MAKPGFRLAL FATLLALIVV LLGAYTRLTH AGLGCPDWPG CYGFISVPKS EAQLAHAELH        60
     YPDSPVEAHK GWNEMIHRYF AGTLGLLISI LAGRAWVNRR HPGQPLKLPL FLLAVVFAQA       120
     AFGMWTVTLK LWPQVVTGHL LGGFATLSLL FLLTLRLSGV LPALTVPKRL QYWATAGLLL       180
     VIGQIALGGW VSSNYAAVAC IDFPTCHGQW LPPADFANGF HLTQHIGPNY LGGQLDSDAR       240
     TAIHLTHRIG ALLVTVVLLG LAWQLKVVGM TRLAGLVLIA LGAQITLGIS NVLFHLPLPV       300
     AVAHNAGGAA LLLTMVLVNY HARTSLVRVR QPMIARWRLS PRKHSAAPIT IKGETPWRF        359
//

If you have problems or comments...

PBIL Back to PBIL home page