(data stored in ACNUC7421 zone)

EMBL: CP000094.PE76

CP000094.PE76        Location/Qualifiers
FT   CDS             complement(79897..80784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0076"
FT                   /product="putative cytochrome C oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71820"
FT                   /db_xref="GOA:Q3KK86"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK86"
FT                   /protein_id="ABA71820.1"
FT                   /translation="MATHEHYYVPAQSKWPIVATVGMFVTVYGLATWFNDLKAARPESH
FT                   GPLIFFVGGLLLAYMLFGWFGTVIKESRAGLYSPQLDRSFRWGMSWFIFSEVMFFIAFF
FT                   GALFYVRHISGPALGGEGTKGIAHMLWPNFQFTWPLLHTPDPKLFPPPKEVISPWGLPL
FT                   INTILLVSSSVTITIAHHALKKGHRGALKLWLAITVLLGCAFLGFQAEEYIHAYHELGL
FT                   TLGSGIYGATFFMLTGFHGAHVTIGTIILFVMLMRIMKGHFDNEHQFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVL"
     MATHEHYYVP AQSKWPIVAT VGMFVTVYGL ATWFNDLKAA RPESHGPLIF FVGGLLLAYM        60
     LFGWFGTVIK ESRAGLYSPQ LDRSFRWGMS WFIFSEVMFF IAFFGALFYV RHISGPALGG       120
     EGTKGIAHML WPNFQFTWPL LHTPDPKLFP PPKEVISPWG LPLINTILLV SSSVTITIAH       180
     HALKKGHRGA LKLWLAITVL LGCAFLGFQA EEYIHAYHEL GLTLGSGIYG ATFFMLTGFH       240
     GAHVTIGTII LFVMLMRIMK GHFDNEHQFG FEAASWYWHF VDVVWIGLFI FVYVL            295
//

If you have problems or comments...

PBIL Back to PBIL home page