(data stored in ACNUC7421 zone)

EMBL: CP000094.PE78

CP000094.PE78        Location/Qualifiers
FT   CDS             complement(81389..82981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0078"
FT                   /product="putative cytochrome C oxydase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71822"
FT                   /db_xref="GOA:Q3KK84"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK84"
FT                   /protein_id="ABA71822.1"
FT                   /translation="MSAVIDDHGHADHDHAHGPAKGLMRWVLTTNHKDIGTLYLWFAFC
FT                   MFLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLVMVFGAVMPAFVGLANWMIPL
FT                   MVGAPDMALPRMNNFSFWLLPAAFLLLVSTLFTAGGGPNFGWTFYAPLSTTYAPESVTF
FT                   FIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   CVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSQIIPTFSR
FT                   KPLFGYTSMVYATASIAFLSFIVWAHHMFVVGIPLVGELFFMYATMLIAVPTGVKVFNW
FT                   ASTMWQGSMTFETPMLFAVAFVILFSIGGFSGLMLAIAPADFQYQDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFVGMNLTFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGATQIFFLFIVIKTIRGGEPAPAKPWDGAEGLEWSVPSP
FT                   APYHTFTTPPEVK"
     MSAVIDDHGH ADHDHAHGPA KGLMRWVLTT NHKDIGTLYL WFAFCMFLLG GSFAMVIRAE        60
     LFQPGLQIVE PAFFNQMTTM HGLVMVFGAV MPAFVGLANW MIPLMVGAPD MALPRMNNFS       120
     FWLLPAAFLL LVSTLFTAGG GPNFGWTFYA PLSTTYAPES VTFFIFAIHL MGISSIMGAI       180
     NVIATILNLR APGMTLMKMP LFVWTWLITA FLLIAVMPVL AGCVTMMLMD IHFGTSFFSA       240
     AGGGDPVLFQ HVFWFFGHPE VYIMILPAFG AVSQIIPTFS RKPLFGYTSM VYATASIAFL       300
     SFIVWAHHMF VVGIPLVGEL FFMYATMLIA VPTGVKVFNW ASTMWQGSMT FETPMLFAVA       360
     FVILFSIGGF SGLMLAIAPA DFQYQDTYFV VAHFHYVLVP GAIFGIFASA YYWLPKWTGH       420
     MYDETLGKLH FWLSFVGMNL TFFPMHFVGL AGMPRRIPDY NLQFADFNMV SSIGAFMFGA       480
     TQIFFLFIVI KTIRGGEPAP AKPWDGAEGL EWSVPSPAPY HTFTTPPEVK                  530
//

If you have problems or comments...

PBIL Back to PBIL home page