(data stored in ACNUC7421 zone)

EMBL: CP000094.PE80

CP000094.PE80        Location/Qualifiers
FT   CDS             84561..85193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK82"
FT                   /protein_id="ABA71824.1"
FT                   /translation="MNTAALREQIHIARQHEIETGKLTRQLEAQMQHLHPAIQLPETDA
FT                   NGVLTRFVAAYIDEVPDLLDAANEVAREAGIESQIKPVLKIAEQYFLQPPVGLDSLLDE
FT                   AYLAHRFVEEVNDLYIKHLGQPLIPLDMTVANLIAHQLIGEEFANQLDEVVHHAVDSML
FT                   DDDSFALESVEAYREKLSSPDTGAAWKRWPCMSRRLGVGLELDQPAA"
     MNTAALREQI HIARQHEIET GKLTRQLEAQ MQHLHPAIQL PETDANGVLT RFVAAYIDEV        60
     PDLLDAANEV AREAGIESQI KPVLKIAEQY FLQPPVGLDS LLDEAYLAHR FVEEVNDLYI       120
     KHLGQPLIPL DMTVANLIAH QLIGEEFANQ LDEVVHHAVD SMLDDDSFAL ESVEAYREKL       180
     SSPDTGAAWK RWPCMSRRLG VGLELDQPAA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page