(data stored in ACNUC7421 zone)

EMBL: CP000094.PE84

CP000094.PE84        Location/Qualifiers
FT   CDS             complement(88963..90264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0084"
FT                   /product="alcohol dehydrogenase cytochrome C subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71828"
FT                   /db_xref="GOA:Q3KK78"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK78"
FT                   /protein_id="ABA71828.1"
FT                   /translation="MKTLVIATLALLGSAAVHGAEVDQSLIKKGEYLARAGDCVACHTA
FT                   KDGKPFAGGLPMETPIGTIYSTNITPDKTGVGDYSFEDFDQALRHGVAKNGSTLYPAMP
FT                   YPSYARVSEPDMQALYAYFMHGVEPVAQENKASDIPWPLSMRWPLMGWRWLFAPKVEDY
FT                   KPASDDAVVSRGAYLVEGLGHCGACHTPRALTMQEKSLSAAEGSSFLSGSAPLEGWIAK
FT                   SLRGDHKDGLGSWSEEQLVQFLKTGRSDRSAVFGGMSDVVTHSMQYMTDADLTAIARYL
FT                   KSLPANDPADQPHQYDEKAAKALWNGDDSQRGASVYIDNCAACHRTDGHGYTRVFPALA
FT                   GNPVLQSDDPTSLIHIVLKGGTLPATHAAPSTFTMPGFAWRLSDQEVADVVSFIRGSWG
FT                   NKGAPVKAADVAELRKDDMKQTSNDDLGQVTQHN"
     MKTLVIATLA LLGSAAVHGA EVDQSLIKKG EYLARAGDCV ACHTAKDGKP FAGGLPMETP        60
     IGTIYSTNIT PDKTGVGDYS FEDFDQALRH GVAKNGSTLY PAMPYPSYAR VSEPDMQALY       120
     AYFMHGVEPV AQENKASDIP WPLSMRWPLM GWRWLFAPKV EDYKPASDDA VVSRGAYLVE       180
     GLGHCGACHT PRALTMQEKS LSAAEGSSFL SGSAPLEGWI AKSLRGDHKD GLGSWSEEQL       240
     VQFLKTGRSD RSAVFGGMSD VVTHSMQYMT DADLTAIARY LKSLPANDPA DQPHQYDEKA       300
     AKALWNGDDS QRGASVYIDN CAACHRTDGH GYTRVFPALA GNPVLQSDDP TSLIHIVLKG       360
     GTLPATHAAP STFTMPGFAW RLSDQEVADV VSFIRGSWGN KGAPVKAADV AELRKDDMKQ       420
     TSNDDLGQVT QHN                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page