(data stored in ACNUC7421 zone)

EMBL: CP000094.PE96

CP000094.PE96        Location/Qualifiers
FT   CDS             complement(101581..101820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71840"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK66"
FT                   /protein_id="ABA71840.1"
FT                   /translation="MKRFALAVICGVLATSAFAAPKDCEELKQEIEIKIQANAVPSYTL
FT                   EIVSKEEAEKHDIAMIVGTCDNGTKAIIYQKNDR"
     MKRFALAVIC GVLATSAFAA PKDCEELKQE IEIKIQANAV PSYTLEIVSK EEAEKHDIAM        60
     IVGTCDNGTK AIIYQKNDR                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page