(data stored in ACNUC7421 zone)

EMBL: CP000094.PE97

CP000094.PE97        Location/Qualifiers
FT   CDS             complement(101933..102364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0097"
FT                   /product="osmotically inducible protein c"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71841"
FT                   /db_xref="GOA:Q3KK65"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK65"
FT                   /protein_id="ABA71841.1"
FT                   /translation="MAIVKKASAHWEGDLKTGIGSISTETGVLREAPYGFKARFEGGKG
FT                   TNPEELIGAAHAGCFSMAFSMILGDAGLKADSIDTQAEVTLDQVDGGFAITAVKLILKA
FT                   KIPGATQAQFEELSNKAKEGCPVSKVLNAKISLDASLVS"
     MAIVKKASAH WEGDLKTGIG SISTETGVLR EAPYGFKARF EGGKGTNPEE LIGAAHAGCF        60
     SMAFSMILGD AGLKADSIDT QAEVTLDQVD GGFAITAVKL ILKAKIPGAT QAQFEELSNK       120
     AKEGCPVSKV LNAKISLDAS LVS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page