(data stored in ACNUC7421 zone)

EMBL: CP000094.PE99

CP000094.PE99        Location/Qualifiers
FT   CDS             complement(103672..103896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71843"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK63"
FT                   /protein_id="ABA71843.1"
FT                   /translation="MKKLILAVGLLSLAGGAFAAGKPCEELKAEIAAKLDAKGVSGYSL
FT                   EVVDKGAASGGKVVGTCEGGAKEIVYTRG"
     MKKLILAVGL LSLAGGAFAA GKPCEELKAE IAAKLDAKGV SGYSLEVVDK GAASGGKVVG        60
     TCEGGAKEIV YTRG                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page