(data stored in ACNUC7421 zone)

EMBL: CP000094.PILM

CP000094.PILM        Location/Qualifiers
FT   CDS             461682..462746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="Pfl01_0405"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72149"
FT                   /db_xref="GOA:Q3KJA7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA7"
FT                   /protein_id="ABA72149.1"
FT                   /translation="MLGLFNKKANTLLGIDISSTSVKLLELSRQGERYRVEAYAVEPLP
FT                   ANAVVEKNIAELEGVGQALSRVLVKARTGLKTVAVAVAGSAVITKVIEMDAGLSDDELE
FT                   NQLKIEADQYIPYPLDEVAIDFEVQGVSPRNPERVNVLLAACRKENVEVREAALALAGL
FT                   TARVVDVEAYALERSFGLLATQLAASQDRLTVAVVDIGATMTTLSVLHNGRIIYTREQL
FT                   FGGRQLTEEIQRRYGLTLEQAGLAKKQGGLPDDYVSEVLQPFREALVQQVSRSLQFFFA
FT                   SGQYNAVDHILLAGGTASVPGLDRLIEERLHTPTQVANPFSDMALSSKVNAGALASDAP
FT                   ALMIACGLALRSFD"
     MLGLFNKKAN TLLGIDISST SVKLLELSRQ GERYRVEAYA VEPLPANAVV EKNIAELEGV        60
     GQALSRVLVK ARTGLKTVAV AVAGSAVITK VIEMDAGLSD DELENQLKIE ADQYIPYPLD       120
     EVAIDFEVQG VSPRNPERVN VLLAACRKEN VEVREAALAL AGLTARVVDV EAYALERSFG       180
     LLATQLAASQ DRLTVAVVDI GATMTTLSVL HNGRIIYTRE QLFGGRQLTE EIQRRYGLTL       240
     EQAGLAKKQG GLPDDYVSEV LQPFREALVQ QVSRSLQFFF ASGQYNAVDH ILLAGGTASV       300
     PGLDRLIEER LHTPTQVANP FSDMALSSKV NAGALASDAP ALMIACGLAL RSFD             354
//

If you have problems or comments...

PBIL Back to PBIL home page