(data stored in ACNUC7421 zone)

EMBL: CP000094.PILO

CP000094.PILO        Location/Qualifiers
FT   CDS             463309..463932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="Pfl01_0407"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72151"
FT                   /db_xref="GOA:Q3KJA5"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA5"
FT                   /protein_id="ABA72151.1"
FT                   /translation="MKPSEWLDSLRNVDFNDLDTSNIGSWPPVVKGLAGGLLMVLVLAL
FT                   GYNFFISDLESQLELKREEEVTLKEQFASKAHMAANLELYTQQMKEMENSFGVLLRQLP
FT                   SDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVTQQFYIELPIQITVTGAYHDLATFVSG
FT                   VAGLPRIVTLHDFELAPANPEGGPKLRMSILAKTYRYNDKGLQK"
     MKPSEWLDSL RNVDFNDLDT SNIGSWPPVV KGLAGGLLMV LVLALGYNFF ISDLESQLEL        60
     KREEEVTLKE QFASKAHMAA NLELYTQQMK EMENSFGVLL RQLPSDTEVP GLLEDITRTG       120
     LGSGLEFEEI KLLPEVTQQF YIELPIQITV TGAYHDLATF VSGVAGLPRI VTLHDFELAP       180
     ANPEGGPKLR MSILAKTYRY NDKGLQK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page