(data stored in ACNUC7421 zone)

EMBL: CP000094.RECF

CP000094.RECF        Location/Qualifiers
FT   CDS             3246..4349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Pfl01_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71747"
FT                   /db_xref="GOA:Q3KKF9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KKF9"
FT                   /protein_id="ABA71747.1"
FT                   /translation="MSLSRVSVTAVRNLHPVTFSPSPRINILYGANGSGKTSVLEAIHL
FT                   LGLARSFRSTRLLPVIQYEQLACTVFGQVELAEGGHSALGISRDRQGEFQIRIDGQNAR
FT                   SAAQLAEILPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMATWQRLQKALRQRN
FT                   SWLRHGTLDAVSQAVWDRELCQASAEIDEYRRAYIKALKPVFEQTLSELVELEGLTLSY
FT                   YRGWDKDRELSAVLAGSVQRDQQMGHTQAGPQRADLRLRLGAHNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQARRGQCIYLVDDLPSELDESHRRALCRLLEDLRCQVFITCVDHELLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
     MSLSRVSVTA VRNLHPVTFS PSPRINILYG ANGSGKTSVL EAIHLLGLAR SFRSTRLLPV        60
     IQYEQLACTV FGQVELAEGG HSALGISRDR QGEFQIRIDG QNARSAAQLA EILPLQLINP       120
     DSFRLLEGAP KIRRQFLDWG VFHVEPRFMA TWQRLQKALR QRNSWLRHGT LDAVSQAVWD       180
     RELCQASAEI DEYRRAYIKA LKPVFEQTLS ELVELEGLTL SYYRGWDKDR ELSAVLAGSV       240
     QRDQQMGHTQ AGPQRADLRL RLGAHNAADI LSRGQQKLVV CALRIAQGHL VSQARRGQCI       300
     YLVDDLPSEL DESHRRALCR LLEDLRCQVF ITCVDHELLR EGWQTETPVA LFHVEQGRIT       360
     QTHDHRE                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page