(data stored in ACNUC7421 zone)

EMBL: CP000094.RFAP

CP000094.RFAP        Location/Qualifiers
FT   CDS             542658..543464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaP"
FT                   /locus_tag="Pfl01_0468"
FT                   /product="lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72212"
FT                   /db_xref="GOA:Q3KJ44"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ44"
FT                   /protein_id="ABA72212.1"
FT                   /translation="MKLMLAEPFKSLWAGRDPFAEVEGLQGEVYRELEARRTLRTEVDG
FT                   NGFFVKIHRGIGWGEIFKNLLTAKLPVLGAGQEWKAIQRLQEVGVPTMTAVAYGEKGSN
FT                   PADQHSFIVTEELAPTISLEDFSIDWVKQPPQPKLKRALIAEVARMTGMMHRAGVNHRD
FT                   CYICHFLLHTDKPVTPEDFKLSVIDLHRAQTRPAITQRWRNKDLAALYFSALDIGLTRR
FT                   DKLRFLKGYFQQPLRRILAEEAPLLSWLEGKANKLYARKQRYGDAL"
     MKLMLAEPFK SLWAGRDPFA EVEGLQGEVY RELEARRTLR TEVDGNGFFV KIHRGIGWGE        60
     IFKNLLTAKL PVLGAGQEWK AIQRLQEVGV PTMTAVAYGE KGSNPADQHS FIVTEELAPT       120
     ISLEDFSIDW VKQPPQPKLK RALIAEVARM TGMMHRAGVN HRDCYICHFL LHTDKPVTPE       180
     DFKLSVIDLH RAQTRPAITQ RWRNKDLAAL YFSALDIGLT RRDKLRFLKG YFQQPLRRIL       240
     AEEAPLLSWL EGKANKLYAR KQRYGDAL                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page